{"product_id":"proteintech-12448-1-ap","title":"Proteintech, 12448-1-AP, RPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPA1 (12448-1-AP) by Proteintech is a Polyclonal antibody targeting RPA1 in WB, ELISA applications with reactivity to human, mouse samples\n12448-1-AP targets RPA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  Y79 cells,  A431 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReplication protein A 1 (RPA1) is a subunit of a stable heterotrimer replication protein A (RPA), which is conserved in almost all eukaryotic species (PMID: 27151292). Usually, RPA1, RPA2 and RPA3 function as a whole to participate in DNA replication, telomere maintenance, DNA recombination, DNA repair, and activation of DNA damage checkpoints. In the cell, RPA has a higher affinity to bind single strand DNA and then to form a fork protection complex with other components such as PTEN and  OTUB1, thus maintains genome stability during replication(PMID: 26403191; PMID: 18469000).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3067 Product name: Recombinant human RPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-616 aa of BC018126 Sequence: VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM Predict reactive species\nFull Name: replication protein A1, 70kDa\nCalculated Molecular Weight: 616 aa, 68 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC018126\nGene Symbol: RPA1\nGene ID (NCBI): 6117\nRRID: AB_2180495\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27694\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869588672681,"sku":"12448-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12448-1-ap","provider":"Iright","version":"1.0","type":"link"}