{"product_id":"proteintech-12452-1-ap","title":"Proteintech, 12452-1-AP, VPS34 (C terminal) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS34 (C terminal) (12452-1-AP) by Proteintech is a Polyclonal antibody targeting VPS34 (C terminal) in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12452-1-AP targets VPS34 (C terminal) in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, Jurkat cells,  mouse brain tissue,  mouse lung tissue,  mouse testis tissue,  rat brain tissue\nPositive IHC detected in: human prostate cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and  belongs to the PI3\/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3110 Product name: Recombinant human PIK3C3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-887 aa of BC033004 Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK Predict reactive species\nFull Name: phosphoinositide-3-kinase, class 3\nCalculated Molecular Weight: 887 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC033004\nGene Symbol: VPS34\nGene ID (NCBI): 5289\nRRID: AB_2299709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEB9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868835729577,"sku":"12452-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12452-1-ap","provider":"Iright","version":"1.0","type":"link"}