{"product_id":"proteintech-12490-1-ap","title":"Proteintech, 12490-1-AP, USP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP3 (12490-1-AP) by Proteintech is a Polyclonal antibody targeting USP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n12490-1-AP targets USP3 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, K-562 cells,  RAW264.7,  HepG2 cells,  Jurkat cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3085 Product name: Recombinant human USP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC018113 Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK Predict reactive species\nFull Name: ubiquitin specific peptidase 3\nCalculated Molecular Weight: 520 aa, 59 kDa\nObserved Molecular Weight: 53-59 kDa\nGenBank Accession Number: BC018113\nGene Symbol: USP3\nGene ID (NCBI): 9960\nRRID: AB_10639042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6I4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909621417,"sku":"12490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12490-1-ap","provider":"Iright","version":"1.0","type":"link"}