{"product_id":"proteintech-12516-1-ap","title":"Proteintech, 12516-1-AP, ZBTB32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB32 (12516-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB32 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n12516-1-AP targets ZBTB32 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue,  pig lymph node tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe zinc finger and BTB domain containing 32 (ZBTB32) protein, also known as testis zinc finger protein (TZFP) or repressor of GATA (ROG), is a transcription factor belonging to the BTB\/POZ-ZF protein family. It is encoded by the Zbtb32 gene, located on proximal chromosome 7 in the mouse genome. ZBTB32 was shown to ensure proper regulation of meiosis during spermatogenesis by acting as a repressor of the androgen receptor (PMID: 22851713, 34337361).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3199 Product name: Recombinant human ZBTB32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC017700 Sequence: MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS Predict reactive species\nFull Name: zinc finger and BTB domain containing 32\nCalculated Molecular Weight: 487 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC017700\nGene Symbol: ZBTB32\nGene ID (NCBI): 27033\nRRID: AB_3669143\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2Y4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887926825129,"sku":"12516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12516-1-ap","provider":"Iright","version":"1.0","type":"link"}