{"product_id":"proteintech-12518-1-ap","title":"Proteintech, 12518-1-AP, MAP17 \/ PDZK1IP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP17 \/ PDZK1IP1 (12518-1-AP) by Proteintech is a Polyclonal antibody targeting MAP17 \/ PDZK1IP1 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n12518-1-AP targets MAP17 \/ PDZK1IP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDZK1-interacting protein 1(PDZK1IP1), also known as MAP17,  is a membrane-associated protein. MAP17 \/ PDZK1IP1 is overexpressed in a variety of human carcinomas, and overexpression of MAP17 \/ PDZK1IP1 protein is strongly correlated with the progression of prostate and ovarian carcinomas (PMID: 17426052). MAP17 \/ PDZK1IP1 has been proven to be an oncogene for tumorigenesis and development of papillary thyroid cancer (PTC) (PMID: 36057192; PMID: 35727731).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3206 Product name: Recombinant human PDZK1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-114 aa of BC012303 Sequence: VPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVKHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM Predict reactive species\nFull Name: PDZK1 interacting protein 1\nCalculated Molecular Weight: 114 aa, 12 kDa\nGenBank Accession Number: BC012303\nGene Symbol: MAP17\nGene ID (NCBI): 10158\nRRID: AB_3085395\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13113\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869706965161,"sku":"12518-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12518-1-ap","provider":"Iright","version":"1.0","type":"link"}