{"product_id":"proteintech-12530-1-ap","title":"Proteintech, 12530-1-AP, RRAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRAS2 (12530-1-AP) by Proteintech is a Polyclonal antibody targeting RRAS2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n12530-1-AP targets RRAS2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, mouse pancreas tissue\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: mouse heart tissue, human heart tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas-related protein R-Ras2 (RRAS2) is also named TC21 and Teratocarcinoma oncogene. The RRAS2 member of the RAS-related subfamily, also known as TC21, is a close relative of the classic RAS GTPases (PMID: 3898776). RRAS2, a member of the R-Ras subfamily of Ras-like low-molecular-weight GTPases, is located in the plasma membrane and functions as a signal transducer (PMID: 38601074). RRAS2 is GTP-binding protein with GTPase activity, involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PMID: 31130282).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3226 Product name: Recombinant human RRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC013106 Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF Predict reactive species\nFull Name: related RAS viral (r-ras) oncogene homolog 2\nCalculated Molecular Weight: 204 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC013106\nGene Symbol: RRAS2\nGene ID (NCBI): 22800\nRRID: AB_2180206\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62070\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009563817,"sku":"12530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12530-1-ap","provider":"Iright","version":"1.0","type":"link"}