{"product_id":"proteintech-12572-1-ap","title":"Proteintech, 12572-1-AP, EPAC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPAC1 (12572-1-AP) by Proteintech is a Polyclonal antibody targeting EPAC1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, hamster samples\n12572-1-AP targets EPAC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: CHO cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPAC1 functions as a guanine nucleotide exchange factor (GEF), activating small GTPases like Rap1 and Rap2, leading to diverse cellular response. Epac proteins are cAMP sensors that regulate several pivotal cellular processes, including calcium handling, cell proliferation, cell survival, cell differentiation, cell polarization, cell adhesion events, gene transcription, secretion, ion transport, and neuronal signaling. It is a potential target for therapeutic intervention, such as metabolic disorders, cardiovascular diseases (PMID: 20007405, PMID: 20421979). EPAC1 also enhances brown fat growth and beige adipogenesis (PMID: 38195707).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, hamster\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3240 Product name: Recombinant human RAPGEF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 441-788 aa of BC017728 Sequence: HFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALE Predict reactive species\nFull Name: Rap guanine nucleotide exchange factor (GEF) 3\nCalculated Molecular Weight: 881 aa, 99 kDa\nObserved Molecular Weight: 99-104 kDa\nGenBank Accession Number: BC017728\nGene Symbol: EPAC1\/RAPGEF3\nGene ID (NCBI): 10411\nRRID: AB_11232407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95398\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869459206313,"sku":"12572-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12572-1-ap","provider":"Iright","version":"1.0","type":"link"}