{"product_id":"proteintech-12587-1-ap","title":"Proteintech, 12587-1-AP, PDCD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDCD4 (12587-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD4 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n12587-1-AP targets PDCD4 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, MCF-7 cells,  HEK293 cells,  HEK-293 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProgrammed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A. The calculated molecular wight of unmodified PDCD4 protein is 52 kDa, but the modified protein is about 54-64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3288 Product name: Recombinant human PDCD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-469 aa of BC026104 Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY Predict reactive species\nFull Name: programmed cell death 4 (neoplastic transformation inhibitor)\nCalculated Molecular Weight: 469 aa, 52 kDa\nObserved Molecular Weight: 54-64 kDa\nGenBank Accession Number: BC026104\nGene Symbol: PDCD4\nGene ID (NCBI): 27250\nRRID: AB_2162296\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53EL6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852867241,"sku":"12587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12587-1-ap","provider":"Iright","version":"1.0","type":"link"}