{"product_id":"proteintech-12588-1-ap","title":"Proteintech, 12588-1-AP, CRABP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRABP1 (12588-1-AP) by Proteintech is a Polyclonal antibody targeting CRABP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12588-1-AP targets CRABP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse embryo tissue, human spleen tissue,  Transfected HEK-293 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cellular retinoic acid-binding proteins including CRABP1 and CRABP2 bind retinoic acid (RA), an important regulator of cell growth and differentiation, thus play an important role in RA-mediated differentiation and proliferation processes. It has been reported that CRABP1 influences the biological effects of RA in cell-selective manners by enhancing the physiological function of RA in keratinocytes or inhibiting RA-induced differentiation of neuroblastoma cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rabbit, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3291 Product name: Recombinant human CRABP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC022069 Sequence: MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE Predict reactive species\nFull Name: cellular retinoic acid binding protein 1\nCalculated Molecular Weight: 137 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC022069\nGene Symbol: CRABP1\nGene ID (NCBI): 1381\nRRID: AB_2292271\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29762\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964442281,"sku":"12588-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12588-1-ap","provider":"Iright","version":"1.0","type":"link"}