{"product_id":"proteintech-12591-1-ap","title":"Proteintech, 12591-1-AP, AKAP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKAP7 (12591-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP7 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12591-1-AP targets AKAP7 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 15-18 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals. This antibody can recognize all the isoforms of AKAP7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species\nFull Name: A kinase (PRKA) anchor protein 7\nCalculated Molecular Weight: 81 aa, 9 kDa\nObserved Molecular Weight: 11 kDa, 18 kDa, 37 kDa\nGenBank Accession Number: BC016927\nGene Symbol: AKAP7\nGene ID (NCBI): 9465\nRRID: AB_2226037\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992032937,"sku":"12591-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12591-1-ap","provider":"Iright","version":"1.0","type":"link"}