{"product_id":"proteintech-12613-1-ap","title":"Proteintech, 12613-1-AP, HOXB7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXB7 (12613-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB7 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12613-1-AP targets HOXB7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells\nPositive IP detected in: SKOV-3 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXB7 is a member of the homeobox family genes, which are often dysregulated in various cancer types. Particularly HOXB7 amplification and overexpression correlate with poor prognosis in various cancer such as gastric, pancreatic, and lung cancers. Moreover, HOXB7 is known to contribute to cancer progression by promoting epithelial to mesenchymal transition, anticancer drug resistance, and angiogenesis (PMID: 36659836).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3245 Product name: Recombinant human HOXB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC015345 Sequence: MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE Predict reactive species\nFull Name: homeobox B7\nCalculated Molecular Weight: 217 aa, 24 kDa\nObserved Molecular Weight: 24-30 kDa\nGenBank Accession Number: BC015345\nGene Symbol: HOXB7\nGene ID (NCBI): 3217\nRRID: AB_2877867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09629\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869411528873,"sku":"12613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12613-1-ap","provider":"Iright","version":"1.0","type":"link"}