{"product_id":"proteintech-12619-1-ap","title":"Proteintech, 12619-1-AP, MICA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MICA (12619-1-AP) by Proteintech is a Polyclonal antibody targeting MICA in WB, ELISA applications with reactivity to human samples\n12619-1-AP targets MICA in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  SH-SY5Y cells,  U266 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3298 Product name: Recombinant human MICA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-383 aa of BC016929 Sequence: SWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT Predict reactive species\nFull Name: MHC class I polypeptide-related sequence A\nCalculated Molecular Weight: 383 aa, 43 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC016929\nGene Symbol: MICA\nGene ID (NCBI): 100507436\nRRID: AB_10638612\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q29983\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559541929,"sku":"12619-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12619-1-ap","provider":"Iright","version":"1.0","type":"link"}