{"product_id":"proteintech-12636-1-ap","title":"Proteintech, 12636-1-AP, FAK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAK (12636-1-AP) by Proteintech is a Polyclonal antibody targeting FAK in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12636-1-AP targets FAK in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, NIH\/3T3 cells,  HEK-293 cells,  HUVEC cells,  HeLa cells,  Jurkat cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: Hepatocellular carcinoma tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms  produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3331 Product name: Recombinant human FAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species\nFull Name: PTK2 protein tyrosine kinase 2\nCalculated Molecular Weight: 1052 aa, 119 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC028733\nGene Symbol: FAK\nGene ID (NCBI): 5747\nRRID: AB_2173668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868828029097,"sku":"12636-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12636-1-ap","provider":"Iright","version":"1.0","type":"link"}