{"product_id":"proteintech-12661-1-ap","title":"Proteintech, 12661-1-AP, COG8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COG8 (12661-1-AP) by Proteintech is a Polyclonal antibody targeting COG8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12661-1-AP targets COG8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  Raji cells\nPositive IHC detected in: human ovary cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe conserved oligomeric Golgi (COG) complex is an eight subunit (COG1-8) peripheral Golgi membrane hetero-oligomeric protein complex. The COG complex is organized into lobes A (COG2-4) and B (COG5-7) with COG1 and COG8 bridging these lobes and is thought to play a critical role in vesicle tethering processes (PMID: 17331980). Cog8 localizes exclusively in the Golgi apparatus and is involved in the retrograde Golgi transport of resident proteins responsible for sugar chain (glycan) biosynthesis (PMID: 17220172).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3341 Product name: Recombinant human COG8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-612 aa of BC017492 Sequence: MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP Predict reactive species\nFull Name: component of oligomeric golgi complex 8\nCalculated Molecular Weight: 612 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC017492\nGene Symbol: COG8\nGene ID (NCBI): 84342\nRRID: AB_2244993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869658009769,"sku":"12661-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12661-1-ap","provider":"Iright","version":"1.0","type":"link"}