{"product_id":"proteintech-12694-1-ap","title":"Proteintech, 12694-1-AP, SMG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMG5 (12694-1-AP) by Proteintech is a Polyclonal antibody targeting SMG5 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12694-1-AP targets SMG5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMG5 is also named EST1-like protein B (EST1B) and LPTS-RP1. SMG5 is a key Nonsense-mediated mRNA decay (NMD) factor, and NMD factor SMG5 is vital for embryonic development (PMID: 39199410). SMG5 plays a role in the degradation of mRNA through the process of nonsense-mediated decay and encodes a protein. SMG5 has been linked to the development of pancreatic cancer and epiphyseal chondrodysplasia among various illnesses (PMID: 36056355). SMG5 is a kind of RNA-binding proteins (RBPs) (PMID: 37936239). In addition, they have been shown to be key regulators of oncogenesis and tumor progression (PMID: 33228611). SMG5 may be a high-risk factor for HCC prognosis (PMID: 33411682). SMG5 promotes HCC cell proliferation and tumor growth. SMG5 has extensive effects on the proliferation, survival, and tumor growth of HCC cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3424 Product name: Recombinant human SMG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 670-1016 aa of BC038296 Sequence: DLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGCELPDLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKDVLDFYKQWKEIG Predict reactive species\nFull Name: Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)\nCalculated Molecular Weight: 1016 aa, 114 kDa\nGenBank Accession Number: BC038296\nGene Symbol: SMG5\nGene ID (NCBI): 23381\nRRID: AB_2270781\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPR3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869500428457,"sku":"12694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12694-1-ap","provider":"Iright","version":"1.0","type":"link"}