{"product_id":"proteintech-12705-1-ap","title":"Proteintech, 12705-1-AP, TRAM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAM1 (12705-1-AP) by Proteintech is a Polyclonal antibody targeting TRAM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12705-1-AP targets TRAM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells,  Jurkat cells,  PC-3 cells\nPositive IP detected in: mouse pancreas tissue\nPositive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3384 Product name: Recombinant human TRAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-374 aa of BC037738 Sequence: FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS Predict reactive species\nFull Name: translocation associated membrane protein 1\nCalculated Molecular Weight: 374 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC037738\nGene Symbol: TRAM1\nGene ID (NCBI): 23471\nRRID: AB_2282651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15629\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990656681,"sku":"12705-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12705-1-ap","provider":"Iright","version":"1.0","type":"link"}