{"product_id":"proteintech-12718-1-ap","title":"Proteintech, 12718-1-AP, TROVE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TROVE2 (12718-1-AP) by Proteintech is a Polyclonal antibody targeting TROVE2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12718-1-AP targets TROVE2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  HeLa cells,  mouse thymus tissue,  PC-3 cells,  rat spleen tissue\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTROVE2, also named as RO60 or RoRNP, is a 538 amino acid protein, which is localized in cytoplasmic mRNP granules containing untranslated mRNAs. TROVE2 as a RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. TROVE2 may stabilize some of these RNAs and protect them from degradation (PubMed:18056422). TROVE2 binds to endogenous Alu retroelements which are induced by type I IFN and stimulate porinflammaotry cytokine secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3412 Product name: Recombinant human TROVE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-369 aa of BC036658 Sequence: DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK Predict reactive species\nFull Name: TROVE domain family, member 2\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC036658\nGene Symbol: TROVE2\nGene ID (NCBI): 6738\nRRID: AB_2209756\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10155\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869781414057,"sku":"12718-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12718-1-ap","provider":"Iright","version":"1.0","type":"link"}