{"product_id":"proteintech-12751-1-ap","title":"Proteintech, 12751-1-AP, SEC5\/EXOC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC5\/EXOC2 (12751-1-AP) by Proteintech is a Polyclonal antibody targeting SEC5\/EXOC2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12751-1-AP targets SEC5\/EXOC2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  human ileum tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3147 Product name: Recombinant human SEC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 456-806 aa of BC016918 Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT Predict reactive species\nFull Name: exocyst complex component 2\nCalculated Molecular Weight: 924 aa, 104 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC016918\nGene Symbol: SEC5\nGene ID (NCBI): 55770\nRRID: AB_2262528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877476009,"sku":"12751-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12751-1-ap","provider":"Iright","version":"1.0","type":"link"}