{"product_id":"proteintech-12787-1-ap","title":"Proteintech, 12787-1-AP, HMGB4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGB4 (12787-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB4 in WB, ELISA applications with reactivity to human, mouse samples\n12787-1-AP targets HMGB4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHigh mobility group protein B4 (HMGB4) is a new member in the family of HMGB proteins. Unlike other HMGB-proteins, it is a mammalian specific protein that has two HMGB-boxes but lacks the acidic tail. HMGB4 is strongly and preferentially expressed in the adult mouse testis and weakly in the brain, but not in many other tissues (PMID: 18987332). It binds strongly to nuclear structures, regulates chromatin and mediates differentiation of neuronal cells (PMID: 27608812).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3503 Product name: Recombinant human HMGB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC021180 Sequence: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS Predict reactive species\nFull Name: high-mobility group box 4\nCalculated Molecular Weight: 186 aa, 22 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC021180\nGene Symbol: HMGB4\nGene ID (NCBI): 127540\nRRID: AB_10638490\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW32\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869693989033,"sku":"12787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12787-1-ap","provider":"Iright","version":"1.0","type":"link"}