{"product_id":"proteintech-12789-1-ap","title":"Proteintech, 12789-1-AP, human BCL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe human BCL2 (12789-1-AP) by Proteintech is a Polyclonal antibody targeting human BCL2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n12789-1-AP targets human BCL2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  Jurkat cells,  HEK-293 cells,  HL-60 cells,  U-251 cells,  U-937 cells,  MCF-7 cells,  U2OS cells\nPositive IP detected in: HL-60 cells, HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human tonsillitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\nPositive FC (Intra) detected in: Jurkat cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\n1. What is Bcl-2?Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.2. FAQs for Bcl-2a. How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.b. What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rabbit, chicken, zebrafish, hamster, sheep, goat, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species\nFull Name: B-cell CLL\/lymphoma 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC027258\nGene Symbol: BCL2\nGene ID (NCBI): 596\nRRID: AB_2227948\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10415\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868816101545,"sku":"12789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12789-1-ap","provider":"Iright","version":"1.0","type":"link"}