{"product_id":"proteintech-12824-1-ap","title":"Proteintech, 12824-1-AP, VPS53 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS53 (12824-1-AP) by Proteintech is a Polyclonal antibody targeting VPS53 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12824-1-AP targets VPS53 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HEK-293 cells,  human liver tissue,  L02 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3518 Product name: Recombinant human VPS53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species\nFull Name: vacuolar protein sorting 53 homolog (S. cerevisiae)\nCalculated Molecular Weight: 832 aa, 94 kDa\nObserved Molecular Weight: 95-97 kDa\nGenBank Accession Number: BC029560\nGene Symbol: VPS53\nGene ID (NCBI): 55275\nRRID: AB_2215514\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VIR6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792620713,"sku":"12824-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12824-1-ap","provider":"Iright","version":"1.0","type":"link"}