{"product_id":"proteintech-12836-1-ap","title":"Proteintech, 12836-1-AP, GYG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GYG1 (12836-1-AP) by Proteintech is a Polyclonal antibody targeting GYG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12836-1-AP targets GYG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, human testis tissue,  U-251 cells\nPositive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissue,  rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe GYG1 gene encodes glycogenin-1, a core protein in muscle glycogen particles. GYG1 is a glycosyltransferase that forms a short glucose polymer of approximately 10 glucose residues by autoglucosylation (PMID: 25272951 ). Cardiomyopathy and muscle weakness associated with muscle glycogen depletion can also be caused by impaired priming of glycogen synthesis due to inactivation of muscle glycogenin (glycogenin-1) (PMID: 20357282).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3583 Product name: Recombinant human GYG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC031096 Sequence: DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ Predict reactive species\nFull Name: glycogenin 1\nCalculated Molecular Weight: 350 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC031096\nGene Symbol: GYG1\nGene ID (NCBI): 2992\nRRID: AB_2116101\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46976\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869691105449,"sku":"12836-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12836-1-ap","provider":"Iright","version":"1.0","type":"link"}