{"product_id":"proteintech-12838-1-ap","title":"Proteintech, 12838-1-AP, SMARCD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMARCD3 (12838-1-AP) by Proteintech is a Polyclonal antibody targeting SMARCD3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n12838-1-AP targets SMARCD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, BxPC-3 cells,  NIH\/3T3 cells,  C6 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human heart tissue, mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMARCD3 is a component of the SWI\/SNF (mating type switching\/sucrose non-fermenting) chromatin remodeling complex, which evolutionarily conserved from yeast to human, and all complexes contain a core set of conserved components, including BRG1\/Brm-associated factors (BAFs) and a DNA-dependent SWI2\/SNF2-like ATPase, which enables chromatin remodeling. SMARCD3 isoforms bind to several nuclear receptors and transcription factors of various families. SMARCD3 proteins interact in a ligand-independent manner with peroxisome proliferator- activated receptor gamma and enhance its transcriptional activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3896 Product name: Recombinant human SMARCD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC002628 Sequence: MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR Predict reactive species\nFull Name: SWI\/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54-55 kDa\nGenBank Accession Number: BC002628\nGene Symbol: SMARCD3\nGene ID (NCBI): 6604\nRRID: AB_2192157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6STE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989378729,"sku":"12838-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12838-1-ap","provider":"Iright","version":"1.0","type":"link"}