{"product_id":"proteintech-12852-1-ap","title":"Proteintech, 12852-1-AP, CTPS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTPS2 (12852-1-AP) by Proteintech is a Polyclonal antibody targeting CTPS2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12852-1-AP targets CTPS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HeLa cells,  human adrenal gland tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTPS2 (CTP synthase 2) is also named as UTP--ammonia ligase 2 and belongs to the CTP synthase family.It catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen and constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3490 Product name: Recombinant human CTPS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-373 aa of BC034986 Sequence: CGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGF Predict reactive species\nFull Name: CTP synthase II\nCalculated Molecular Weight: 586 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC034986\nGene Symbol: CTPS2\nGene ID (NCBI): 56474\nRRID: AB_10639520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454848169,"sku":"12852-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12852-1-ap","provider":"Iright","version":"1.0","type":"link"}