{"product_id":"proteintech-12876-1-ap","title":"Proteintech, 12876-1-AP, EAAT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EAAT4 (12876-1-AP) by Proteintech is a Polyclonal antibody targeting EAAT4 in WB, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n12876-1-AP targets EAAT4 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive IF-Fro detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nExcitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and\/or phosphorylation (24056007). This antibody recognizes 60-70 kDa of EAAT4 in mouse brain and several other lysate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3554 Product name: Recombinant human SLC1A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-271 aa of BC028721 Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL Predict reactive species\nFull Name: solute carrier family 1 (high affinity aspartate\/glutamate transporter), member 6\nCalculated Molecular Weight: 61.6 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC028721\nGene Symbol: EAAT4\nGene ID (NCBI): 6511\nRRID: AB_10642147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48664\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869457993897,"sku":"12876-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12876-1-ap","provider":"Iright","version":"1.0","type":"link"}