{"product_id":"proteintech-12880-1-ap","title":"Proteintech, 12880-1-AP, GJB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GJB3 (12880-1-AP) by Proteintech is a Polyclonal antibody targeting GJB3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n12880-1-AP targets GJB3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue, mouse ovary tissue,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse placenta tissue, human ovary tumor tissue,  human cervix tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGJB3, also known as Connexin-31 (Cx31), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Mutations in the gene of GJB3 have been described in patients with dominant and recessive hearing impairment and in patients with erythrokeratodermia variabilis (EKV).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, marmoset\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3839 Product name: Recombinant human GJB3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 101-270 aa of BC012918 Sequence: RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI Predict reactive species\nFull Name: gap junction protein, beta 3, 31kDa\nCalculated Molecular Weight: 270 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC012918\nGene Symbol: GJB3\nGene ID (NCBI): 2707\nRRID: AB_2110907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75712\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917911721,"sku":"12880-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12880-1-ap","provider":"Iright","version":"1.0","type":"link"}