{"product_id":"proteintech-12905-1-ap","title":"Proteintech, 12905-1-AP, SLAMF7\/CD319 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLAMF7\/CD319 (12905-1-AP) by Proteintech is a Polyclonal antibody targeting SLAMF7\/CD319 in WB, IHC, ELISA applications with reactivity to human, pig samples\n12905-1-AP targets SLAMF7\/CD319 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IM-9 cells, human spleen tissue,  pig spleen tissue,  Jurkat cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignaling lymphocyte activation molecule (SLAM) family receptors is a group of type I transmembrane receptors belonging to the immunoglobulin superfamily (PMID: 37251372). The SLAM family contains nine members that contain an extracellular segment comprising two or four Ig-like domains (V-like variable and C2-like constant), a transmembrane region and a cytoplasmic tail (PMID: 29662641). They are involved in various physiological and pathological processes, including the regulation of immunological responses and the route of viral entry. SLAMF7, also known as CS1, CRACC or CD319, is expressed on NK cells, CD8+ T lymphocytes, B lymphocytes, and mature dendritic cells (PMID: 28861320). It exerts both activating and inhibitory effects depending on the expression status of SAP or EAT-2. SLAMF7 is overexpressed in multiple myeloma and makes it a target for immunotherapy (PMID: 28861320). The native molecular weight of SLAMF7 is 37 kDa and the apparent molecular mass shifts due to glycosylation (PMID: 11698418; 36381324).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3804 Product name: Recombinant human SLAMF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-227 aa of BC027867 Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMV Predict reactive species\nFull Name: SLAM family member 7\nCalculated Molecular Weight: 335 aa, 37 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC027867\nGene Symbol: SLAMF7\nGene ID (NCBI): 57823\nRRID: AB_2239192\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ25\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869499576489,"sku":"12905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12905-1-ap","provider":"Iright","version":"1.0","type":"link"}