{"product_id":"proteintech-12917-1-ap","title":"Proteintech, 12917-1-AP, PLS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLS3 (12917-1-AP) by Proteintech is a Polyclonal antibody targeting PLS3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12917-1-AP targets PLS3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  NIH\/3T3 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLS3, also named T-plastin and Plastin-3, is an actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia.   It plays an important role in leukocyte function. L-plastin plays an important role in leukocyte function, and T-plastin is possibly involved in DNA repair. Both T- and L-plastin are implicated in several diseases, and L-plastin is considered to be a valuable marker for cancer (PMID: 15960882).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3574 Product name: Recombinant human PLS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC039049 Sequence: LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV Predict reactive species\nFull Name: plastin 3 (T isoform)\nCalculated Molecular Weight: 630 aa, 71 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC039049\nGene Symbol: PLS3\nGene ID (NCBI): 5358\nRRID: AB_2877892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869731541161,"sku":"12917-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12917-1-ap","provider":"Iright","version":"1.0","type":"link"}