{"product_id":"proteintech-12920-1-ap","title":"Proteintech, 12920-1-AP, BVES Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BVES (12920-1-AP) by Proteintech is a Polyclonal antibody targeting BVES in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12920-1-AP targets BVES in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBVES, also named as POP1, POPDC1 and hBVES, belongs to the popeye family. It is cell adhesion molecule involved in the establishment and\/or maintenance of cell integrity. It is involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. It is also involved in striated muscle regeneration and repair and in the regulation of cell spreading. BVES is expressed in the progenitors of coronary artery smooth muscle cells as well as in differentiated smooth muscle cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3593 Product name: Recombinant human BVES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-360 aa of BC034425 Sequence: LYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP Predict reactive species\nFull Name: blood vessel epicardial substance\nCalculated Molecular Weight: 360 aa, 41 kDa\nObserved Molecular Weight: 41-70 kDa\nGenBank Accession Number: BC034425\nGene Symbol: BVES\nGene ID (NCBI): 11149\nRRID: AB_10640584\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NE79\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869518975145,"sku":"12920-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12920-1-ap","provider":"Iright","version":"1.0","type":"link"}