{"product_id":"proteintech-12927-1-ap","title":"Proteintech, 12927-1-AP, TXNL4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNL4B (12927-1-AP) by Proteintech is a Polyclonal antibody targeting TXNL4B in WB, ELISA applications with reactivity to human, mouse, rat samples\n12927-1-AP targets TXNL4B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNL4B(Thioredoxin-like protein 4B) is also named as DIM2, DLP and belongs to the DIM1 family. It is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing. It is required for S\/G(2) transition.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3620 Product name: Recombinant human TXNL4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC009646 Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI Predict reactive species\nFull Name: thioredoxin-like 4B\nCalculated Molecular Weight: 149 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC009646\nGene Symbol: TXNL4B\nGene ID (NCBI): 54957\nRRID: AB_2877893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869783806121,"sku":"12927-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12927-1-ap","provider":"Iright","version":"1.0","type":"link"}