{"product_id":"proteintech-12941-1-ap","title":"Proteintech, 12941-1-AP, PSMF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMF1 (12941-1-AP) by Proteintech is a Polyclonal antibody targeting PSMF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12941-1-AP targets PSMF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human kidney tissue,  human heart tissue,  Jurkat cells,  Neuro-2a cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMF1 is also named as PI31(proteasome (prosome, macropain) inhibitor subunit 1)  and belongs to proteasome inhibitor PI31 family. PI31, which localizes at the nuclear envelope\/endoplasmic reticulum membrane, acts as a selective modulator of the proteasome-mediated steps in MHC class I antigen processing(PMID:18495667). PI31 does not inhibit cell-surface transport of glycoproteins in general and it may serve to control immunoproteasome formation and may thereby maintain an intracellular balance between constitutive and immunoproteasomes(PMID:12374861).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4011 Product name: Recombinant human PSMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-271 aa of BC029836 Sequence: RTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL Predict reactive species\nFull Name: proteasome (prosome, macropain) inhibitor subunit 1 (PI31)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC029836\nGene Symbol: PSMF1\nGene ID (NCBI): 9491\nRRID: AB_2268855\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92530\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869577924777,"sku":"12941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12941-1-ap","provider":"Iright","version":"1.0","type":"link"}