{"product_id":"proteintech-12963-1-ap","title":"Proteintech, 12963-1-AP, CHAD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHAD (12963-1-AP) by Proteintech is a Polyclonal antibody targeting CHAD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12963-1-AP targets CHAD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChondroadherin (CHAD), also known as cartilage leucine-rich protein, is a prominent noncollagenous extracellular protein in cartilage. It was first isolated from bovine cartilage. The primary structure of CHAD shows that it belongs to the family of leucine-rich repeat (LRR) proteins. It is expressed at high levels in certain zones of cartilage and also has been detected in bone, tendon, bone marrow, and chondrosarcoma cells. CHAD promotes attachment of chondrocytes, fibroblasts, and osteoblasts, mediated via the integrin alpha2beta1. It has also been shown to bind to collagen type II and both collagen type II and chondroadherin interact with integrin alpha2beta1. Besides, CHAD may play an important role in the regulation of chondrocyte growth and proliferation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4077 Product name: Recombinant human CHAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-359 aa of BC036360 Sequence: QNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH Predict reactive species\nFull Name: chondroadherin\nCalculated Molecular Weight: 359 aa, 40.5 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC036360\nGene Symbol: CHAD\nGene ID (NCBI): 1101\nRRID: AB_2244851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15335\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869655322793,"sku":"12963-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12963-1-ap","provider":"Iright","version":"1.0","type":"link"}