{"product_id":"proteintech-12981-1-ap","title":"Proteintech, 12981-1-AP, NFYA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFYA (12981-1-AP) by Proteintech is a Polyclonal antibody targeting NFYA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n12981-1-AP targets NFYA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  HT-1080 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFYA, also named as Nuclear transcription factor Y subunit alpha, is a 347 amino acid protein, which contains 1 NFYA\/HAP2-type DNA-binding domain and belongs to the NFYA\/HAP2 subunit family.  NFYA exists the two 41- to 45-kDa isoforms of NF-YA ( 11287613 ). NFYA is a component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL\/BMAL1\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3604 Product name: Recombinant human NFYA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC039244 Sequence: MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGG Predict reactive species\nFull Name: nuclear transcription factor Y, alpha\nCalculated Molecular Weight: 318aa,34 kDa; 347aa,39 kDa\nObserved Molecular Weight: 40 kDa, 46 kDa\nGenBank Accession Number: BC039244\nGene Symbol: NFYA\nGene ID (NCBI): 4800\nRRID: AB_10644128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005729961,"sku":"12981-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12981-1-ap","provider":"Iright","version":"1.0","type":"link"}