{"product_id":"proteintech-12989-1-ap","title":"Proteintech, 12989-1-AP, GSPT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSPT2 (12989-1-AP) by Proteintech is a Polyclonal antibody targeting GSPT2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12989-1-AP targets GSPT2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NIH\/3T3 cells,  PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSPT2, also named as Eukaryotic peptide chain release factor GTP-binding subunit ERF3B or G1 to S phase transition protein 2 homolog, is a 628 amino acid protein, which belongs to the GTP-binding elongation factor family. ERF3 subfamily. GSPT2 localizes in the cytoplasm and is highly expressed in IUCC stage II colorectal cancer (CRC). GSPT2 is involved in translation termination in response to the termination codons UAA, UAG and UGA and may play a role as a potent stimulator of the release factor activity of ETF1. It may play a role in cell cycle progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3641 Product name: Recombinant human GSPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC036077 Sequence: MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK Predict reactive species\nFull Name: G1 to S phase transition 2\nCalculated Molecular Weight: 628 aa, 69 kDa\nObserved Molecular Weight: 69-75 kDa\nGenBank Accession Number: BC036077\nGene Symbol: GSPT2\nGene ID (NCBI): 23708\nRRID: AB_2115511\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998815913,"sku":"12989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12989-1-ap","provider":"Iright","version":"1.0","type":"link"}