{"product_id":"proteintech-13003-2-ap","title":"Proteintech, 13003-2-AP, FAT10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAT10 (13003-2-AP) by Proteintech is a Polyclonal antibody targeting FAT10 in WB, IHC, ELISA applications with reactivity to human samples\n13003-2-AP targets FAT10 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TNF alpha and IFN gamma treated HepG2 cells\nPositive IHC detected in: human tonsillitis tissue, human lung cancer tissue,  human lymphoma tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAT10, also named UBD, contains two ubiquitin-like domains. It is a ubiquitin-like protein modifier that can be covalently attached to the target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. FAT10 also has important roles in cell mitosis, chromosome instability, apoptosis, and immune response. FAT10 mediates apoptosis in a caspase-dependent manner, especially in the renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN). It promotes the expression of the proteasome subunit beta type-9 (PSMB9\/LMP2). FAT10 regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. It may be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. FAT10 may be a marker for precancerous lesions and may promote cancer progression. This antibody is a rabbit polyclonal antibody raised against full-length FAT10 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3680 Product name: Recombinant human UBD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC012472 Sequence: MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG Predict reactive species\nFull Name: ubiquitin D\nCalculated Molecular Weight: 165 aa, 18 kDa\nObserved Molecular Weight: 20 kDa, 70kDa\nGenBank Accession Number: BC012472\nGene Symbol: FAT10\nGene ID (NCBI): 10537\nRRID: AB_2304122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15205\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868884521129,"sku":"13003-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13003-2-ap","provider":"Iright","version":"1.0","type":"link"}