{"product_id":"proteintech-13006-1-ap","title":"Proteintech, 13006-1-AP, CMAS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMAS (13006-1-AP) by Proteintech is a Polyclonal antibody targeting CMAS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13006-1-AP targets CMAS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat pancreas tissue, mouse brain tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), a key enzyme in the incorporation pathway, catalyzes the synthesis of CMP-sialic acid by utilizing CTP and sialic acid. Neu5Ac is activated in the nucleus by CMAS to form CMP-Neu5Ac, which is transported to the Golgi apparatus by SLC35A1  for sialylation of glycoproteins and gangliosides catalyzed by specific sialy ltransferases (PMID: 30568043). Low CMAS gene expression correlated with reduced recurrence-free survival in a human colorectal cancer cohort (PMID: 30578646). Western blots indicated a range of bands at ~ 48 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3686 Product name: Recombinant human CMAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC016609 Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR Predict reactive species\nFull Name: cytidine monophosphate N-acetylneuraminic acid synthetase\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC016609\nGene Symbol: CMAS\nGene ID (NCBI): 55907\nRRID: AB_3085404\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886648479913,"sku":"13006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13006-1-ap","provider":"Iright","version":"1.0","type":"link"}