{"product_id":"proteintech-13054-1-ap","title":"Proteintech, 13054-1-AP, THRSP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe THRSP (13054-1-AP) by Proteintech is a Polyclonal antibody targeting THRSP in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13054-1-AP targets THRSP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue, human liver cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:100-1:600\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTHRSP (Thyroid hormone-inducible hepatic protein)  is a protein that in humans is encoded by the THRSP gene. The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism (RefSeq). This antibody works well in IHC, WB and IF.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3721 Product name: Recombinant human THRSP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC031989 Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW Predict reactive species\nFull Name: thyroid hormone responsive (SPOT14 homolog, rat)\nCalculated Molecular Weight: 146 aa, 17 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC031989\nGene Symbol: THRSP\nGene ID (NCBI): 7069\nRRID: AB_2877906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92748\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945862825,"sku":"13054-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13054-1-ap","provider":"Iright","version":"1.0","type":"link"}