{"product_id":"proteintech-13067-2-ap","title":"Proteintech, 13067-2-AP, SLC1A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC1A4 (13067-2-AP) by Proteintech is a Polyclonal antibody targeting SLC1A4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13067-2-AP targets SLC1A4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, mouse brain tissue,  human skeletal muscle tissue,  SW480 cells,  mouse kidney tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse kidney tissue, human kidney tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3763 Product name: Recombinant human SLC1A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-532 aa of BC026216 Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL Predict reactive species\nFull Name: solute carrier family 1 (glutamate\/neutral amino acid transporter), member 4\nCalculated Molecular Weight: 532 aa, 56 kDa\nObserved Molecular Weight: 62-70 kDa\nGenBank Accession Number: BC026216\nGene Symbol: SLC1A4\nGene ID (NCBI): 6509\nRRID: AB_2190604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973650089,"sku":"13067-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13067-2-ap","provider":"Iright","version":"1.0","type":"link"}