{"product_id":"proteintech-13085-1-ap","title":"Proteintech, 13085-1-AP, CTNS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTNS (13085-1-AP) by Proteintech is a Polyclonal antibody targeting CTNS in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13085-1-AP targets CTNS in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CTNS or cystinosin is a lysosomal membrane protein which comprises with seven transmembrane domains, a 128 amino acid N-terminal region bearing seven N-glycosylation sites and a cytosolic C-terminal GYDQL sorting motif. It functions as a H+-driven cystine transporter responsible for cystine export from lysosomes. The mutation of CTNS gene cause an inherited disorder, cystinosis, characterized by defective lysosomal efflux of cystine. This antibody was raised against the N-terminal region of human cystinosin. Two isoforms of CTNS exist due to alternative splicing events and both of them can be detected through this antibody.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3904 Product name: Recombinant human CTNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-170 aa of BC032850 Sequence: VSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGF Predict reactive species\nFull Name: cystinosis, nephropathic\nCalculated Molecular Weight: 400aa,45 kDa; 367aa,42 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC032850\nGene Symbol: CTNS\nGene ID (NCBI): 1497\nRRID: AB_2230084\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60931\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869401895081,"sku":"13085-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13085-1-ap","provider":"Iright","version":"1.0","type":"link"}