{"product_id":"proteintech-13120-1-ap","title":"Proteintech, 13120-1-AP, TEAD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TEAD3 (13120-1-AP) by Proteintech is a Polyclonal antibody targeting TEAD3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13120-1-AP targets TEAD3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HepG2 cells,  MCF-7 cells,  L02 cells,  MDA-MB-231 cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEAD3, others named ranscriptional enhancer factor 5(TEF5), a member of family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involve in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA\/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in placenta and choriocarcinoma cells(JEG-3), but low in Hela, HepG2 and MCF-7. This is a rabbit polyclonal anti-TEAD3 antibody raised against part of C-terminal chain of human TEAD3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3875 Product name: Recombinant human TEAD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC027877 Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD Predict reactive species\nFull Name: TEA domain family member 3\nCalculated Molecular Weight: 435 aa, 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC027877\nGene Symbol: TEAD3\nGene ID (NCBI): 7005\nRRID: AB_2203068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99594\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961394857,"sku":"13120-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13120-1-ap","provider":"Iright","version":"1.0","type":"link"}