{"product_id":"proteintech-13143-1-ap","title":"Proteintech, 13143-1-AP, PLS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLS1 (13143-1-AP) by Proteintech is a Polyclonal antibody targeting PLS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13143-1-AP targets PLS1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse colon tissue,  mouse kidney tissue\nPositive IHC detected in: human kidney tissue, Human Colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLS1 also known as Fimbrin, Plastin 1, is an actin-binding protein in the absence of calcium. In the inner ear, PLS1 is required for stereocilia formation. PLS1 Mediates liquid packing of actin filaments that is necessary for stereocilia to grow to their proper dimensions. PLS1 is specifically expressed at high levels in the small intestine, colon, and kidney; relatively expressed at lower levels in the lung and stomach(PMID: 8139549). PLS1 is required for normal hearing in humans and mice. Mutations in PLS1, encoding fimbrin, cause autosomal dominant nonsyndromic hearing loss(NSHL)(PMID: 31397523).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3532 Product name: Recombinant human PLS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-629 aa of BC031083 Sequence: DLKRAGLMLQEADKLGCKQFVTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWRHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK Predict reactive species\nFull Name: plastin 1 (I isoform)\nCalculated Molecular Weight: 629 aa, 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC031083\nGene Symbol: PLS1\nGene ID (NCBI): 5357\nRRID: AB_2935432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766360233,"sku":"13143-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13143-1-ap","provider":"Iright","version":"1.0","type":"link"}