{"product_id":"proteintech-13151-1-ap","title":"Proteintech, 13151-1-AP, UGDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGDH (13151-1-AP) by Proteintech is a Polyclonal antibody targeting UGDH in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13151-1-AP targets UGDH in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3767 Product name: Recombinant human UGDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC022781 Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ Predict reactive species\nFull Name: UDP-glucose dehydrogenase\nCalculated Molecular Weight: 494 aa, 55 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC022781\nGene Symbol: UGDH\nGene ID (NCBI): 7358\nRRID: AB_2214083\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60701\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961853609,"sku":"13151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13151-1-ap","provider":"Iright","version":"1.0","type":"link"}