{"product_id":"proteintech-13154-1-ap","title":"Proteintech, 13154-1-AP, ST3GAL6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ST3GAL6 (13154-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13154-1-AP targets ST3GAL6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, human heart tissue,  Sp2\/0 cells,  human placenta tissue\nPositive IHC detected in: human liver tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nST3GAL6, also named as SIAT10, belongs to the glycosyltransferase 29 family. ST3GAL6 is involved in the synthesis of sialyl-paragloboside, which is a precursor of sialyl-Lewis X determinant. ST3GAL6 has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. ST3GAL6 is known to promote cell adhesion and migration of multiple myeloma cells by increasing the synthesis of selectin ligands. ST3GAL6 has 2 isoforms with the molecular mass of 25 and 38 kDa. Sometimes higher molecular weight about 50-60 kDa can also be observed, which may be a glycosylated modified variant of ST3GAL6. (PMID: 31914669, 30220088)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3782 Product name: Recombinant human ST3GAL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-331 aa of BC023312 Sequence: GTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD Predict reactive species\nFull Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 6\nCalculated Molecular Weight: 331 aa, 38 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC023312\nGene Symbol: ST3GAL6\nGene ID (NCBI): 10402\nRRID: AB_10646441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y274\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990001321,"sku":"13154-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13154-1-ap","provider":"Iright","version":"1.0","type":"link"}