{"product_id":"proteintech-13188-1-ap","title":"Proteintech, 13188-1-AP, CLEC2D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC2D (13188-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC2D in WB, ELISA applications with reactivity to human samples\n13188-1-AP targets CLEC2D in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Jurkat cells,  Saos-2 cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC2D (C-type lectin domain family 2 member D), also known as LLT1 (lectin-like transcript 1) or OCIL (Osteoclast inhibitory lectin), is a single-pass type II membrane protein expressed by hematopoietic cells and osteoblasts (PMID: 21930700; 14753741). Its expression was found to be tightly correlated with activation on T cells, NK cells, B cells, and DCs (PMID: 21930700). CLEC2D is a ligand for the human NKR-P1A (CD161) receptor and their interaction differentially regulates NK- and T-cell functions (PMID: 16339513, 16339512). It inhibits the formation and function of osteoclasts and modulates the release of interferon-gamma by human NK cells (PMID:14753741; 20415786).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3862 Product name: Recombinant human CLEC2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC019883 Sequence: MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ Predict reactive species\nFull Name: C-type lectin domain family 2, member D\nCalculated Molecular Weight: 154 aa, 18 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC019883\nGene Symbol: CLEC2D\nGene ID (NCBI): 29121\nRRID: AB_2877920\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886608437417,"sku":"13188-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13188-1-ap","provider":"Iright","version":"1.0","type":"link"}