{"product_id":"proteintech-13192-1-ap","title":"Proteintech, 13192-1-AP, SAA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAA (13192-1-AP) by Proteintech is a Polyclonal antibody targeting SAA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n13192-1-AP targets SAA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: serum from mouse injected with bacteria\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman SAA proteins are a group of apolipoproteins mainly found in the high density lipoprotein (HDL) portion of plasma. The serum amyloid A (SAA) protein is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under the regulation of inflammatory cytokines(PMID: 12011456). Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein(PMID: 1463770). This antibody can recognize SAA1 and SAA2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3869 Product name: Recombinant human SAA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC020795 Sequence: MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Predict reactive species\nFull Name: serum amyloid A2\nCalculated Molecular Weight: 122 aa, 14 kDa\nObserved Molecular Weight: 12-13 kDa\nGenBank Accession Number: BC020795\nGene Symbol: SAA2\nGene ID (NCBI): 6289\nRRID: AB_2877923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0DJI9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973453481,"sku":"13192-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13192-1-ap","provider":"Iright","version":"1.0","type":"link"}