{"product_id":"proteintech-13210-1-ap","title":"Proteintech, 13210-1-AP, PPP3R1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP3R1 (13210-1-AP) by Proteintech is a Polyclonal antibody targeting PPP3R1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13210-1-AP targets PPP3R1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  human stomach tissue,  K-562 cells,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse testis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein phosphatase 3 (PPP3, formerly PP2B, Calcineurin),  a serine\/ threonine protein phosphatase, is a heterodimer composed of one catalytic subunit (PPP3C, Calcineurin A) and one regulatory subunit (PPP3R, Calcineurin B). PPP3R has two isoforms, PPP3R1 and PPP3R2. PPP3Rl is ubiquitously expressed in different tissues and is coded by the PPP3R1 gene which was mapped recently to human chromosome 2. PPP3Rl has four functional calcium-binding sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3992 Product name: Recombinant human PPP3R1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC027913 Sequence: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV Predict reactive species\nFull Name: protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform\nCalculated Molecular Weight: 170 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC027913\nGene Symbol: PPP3R1\nGene ID (NCBI): 5534\nRRID: AB_2252760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63098\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972142761,"sku":"13210-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13210-1-ap","provider":"Iright","version":"1.0","type":"link"}