{"product_id":"proteintech-13230-1-ap","title":"Proteintech, 13230-1-AP, SIGLEC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIGLEC5 (13230-1-AP) by Proteintech is a Polyclonal antibody targeting SIGLEC5 in WB, ELISA applications with reactivity to human samples\n13230-1-AP targets SIGLEC5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSialic acid binding Ig-like lectin 5 (Siglec-5), also known as CD170, is a member of the CD33-related Siglec subfamily. Siglec-5 is a type-I transmembrane protein consisting of an N-terminal extracellular region that contains four extracellular immunoglobulin-like domains, a transmembrane region, and an intracellular domain with two tyrosine-based motifs (PMID: 9731071). It is expressed on neutrophils, monocytes, dendritic cells, and subsets of tissue macrophages (PMID: 15769739). Siglec-5 binds alpha-2,3-linked, alpha-2,6-linked sialic acid, and is involved in cell adhesion (PMID: 18022638).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4101 Product name: Recombinant human SIGLEC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-442 aa of BC029896 Sequence: IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLLQGRSNLGTGVVPAALG Predict reactive species\nFull Name: sialic acid binding Ig-like lectin 5\nCalculated Molecular Weight: 551 aa, 61 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC029896\nGene Symbol: SIGLEC5\nGene ID (NCBI): 8778\nRRID: AB_10643385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15389\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869598535849,"sku":"13230-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13230-1-ap","provider":"Iright","version":"1.0","type":"link"}