{"product_id":"proteintech-13254-1-ap","title":"Proteintech, 13254-1-AP, FGFBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGFBP2 (13254-1-AP) by Proteintech is a Polyclonal antibody targeting FGFBP2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n13254-1-AP targets FGFBP2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells,  BxPC-3 cells\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor-binding protein 2 (FGFBP2), also known as 37 kDa killer-specific secretory protein (KSP37), is a member of the fibroblast growth factor binding protein family. FGFBP2 was identified as a Th1\/Tc1 specific secretory protein is expressed preferentially in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells and might be involved in essential processes of CTL-mediated immunity. An increase expression of FGFBP2 may be associated with atopic asthma and mild extrinsic asthma. Recently, an observation revealed that FGFBP2 correlate strongly with histology, stage and outcome in ovarian, and it might be a potential prognostic biomarker. The observed MW of FGFBP2 (37 kDa) varies from the predicated MW of 28 kDa, which may be due to the specific space conformation caused by internal disulfide bonds.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4036 Product name: Recombinant human FGFBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-223 aa of BC025720 Sequence: PRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG Predict reactive species\nFull Name: fibroblast growth factor binding protein 2\nCalculated Molecular Weight: 223 aa, 28 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC025720\nGene Symbol: FGFBP2\nGene ID (NCBI): 83888\nRRID: AB_2103095\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869683699881,"sku":"13254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13254-1-ap","provider":"Iright","version":"1.0","type":"link"}