{"product_id":"proteintech-13255-1-ap","title":"Proteintech, 13255-1-AP, SPPL2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPPL2A (13255-1-AP) by Proteintech is a Polyclonal antibody targeting SPPL2A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13255-1-AP targets SPPL2A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human colon tissue,  Jurkat cells,  mouse colon tissue\nPositive IHC detected in: human testis tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPPL2A(Signal peptide peptidase-like 2A) is also named as IMP3(Intramembrane protease 3), PSL2(Presenilin-like protein 2) and belongs to the peptidase A22B family. It is an aspartyl intramembrane protease, has been implicated in the proteolysis of TNF-alpha, Fas Ligand and Bri2 and endogenous signal-peptide-peptidase-like2A (SPPL2a) is localised in lysosomes\/late endosomes(PMID:21896273). This protein has a signal peptide with 25 amino acid and seven glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3935 Product name: Recombinant human SPPL2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-520 aa of BC025740 Sequence: ITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ Predict reactive species\nFull Name: signal peptide peptidase-like 2A\nCalculated Molecular Weight: 520 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC025740\nGene Symbol: SPPL2A\nGene ID (NCBI): 84888\nRRID: AB_2195000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887815315625,"sku":"13255-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13255-1-ap","provider":"Iright","version":"1.0","type":"link"}