{"product_id":"proteintech-13261-3-ap","title":"Proteintech, 13261-3-AP, DLX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLX3 (13261-3-AP) by Proteintech is a Polyclonal antibody targeting DLX3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n13261-3-AP targets DLX3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: JAR cells, mouse lung tissue,  NCCIT cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDistal-less homeobox 3 (DLX3), a member of the Dlx family, plays a crucial role in epithelium, hair, bone, tooth and placental development. DLX3 is expressed during the calcium (Ca2+)-dependent epidermal differentiation process. The calculated molecular weight of DLX3 is 32 kDa. This antibody detects the 32-38 kDa protein in SDS-PAGE. (PMID: 31029881)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3865 Product name: Recombinant human DLX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC028970 Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY Predict reactive species\nFull Name: distal-less homeobox 3\nCalculated Molecular Weight: 287 aa, 32 kDa\nObserved Molecular Weight: 32-38 kDa\nGenBank Accession Number: BC028970\nGene Symbol: DLX3\nGene ID (NCBI): 1747\nRRID: AB_2292996\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60479\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403435177,"sku":"13261-3-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-13261-3-ap","provider":"Iright","version":"1.0","type":"link"}